DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and phox2ba

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001139175.1 Gene:phox2ba / 795258 ZFINID:ZDB-GENE-090313-51 Length:155 Species:Danio rerio


Alignment Length:123 Identity:52/123 - (42%)
Similarity:66/123 - (53%) Gaps:26/123 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 MERPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKR 211
            ::..||.||.||.||:.||..|||||..|||||::|||:|...:.|:||||||||||||||:||:
Zfish     7 VQERRKQRRVRTIFTSAQLKALERAFAHTQYPDIYTREELVQEIQLTEARVQVWFQNRRAKFRKQ 71

  Fly   212 EKFM----------------NQDKAGYLLPEQGLPEFPL---------GIPLPPHGLP 244
            |:..                :.:.|....|:...|..||         ..| ||..||
Zfish    72 ERAASWNESSSKTHSSPSHDSSETASATDPDSTQPSLPLIGDQKQDSRDRP-PPEELP 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 35/52 (67%)
phox2baNP_001139175.1 Homeobox 17..69 CDD:278475 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.