Sequence 1: | NP_788420.1 | Gene: | hbn / 47894 | FlyBaseID: | FBgn0008636 | Length: | 409 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001093155.1 | Gene: | RHOXF2B / 727940 | HGNCID: | 33519 | Length: | 288 | Species: | Homo sapiens |
Alignment Length: | 267 | Identity: | 62/267 - (23%) |
---|---|---|---|
Similarity: | 94/267 - (35%) | Gaps: | 106/267 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 66 GHPHHIHHLH---SSNSNGSNHLSHQQQQQHSQQQHHSQQQQQQQQLQVQAKREDSPTNTDGGLD 127
Fly 128 VDNDDELSSSLNNGHDLSDMERPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDL 192
Fly 193 SEARVQVWFQNRRAKWRKREKFMNQDKAGYLLPEQG----------------------------- 228
Fly 229 ----------LPEF-PLGIPLPPHGLPGHPGSMQSEFWPPHFALHQHFNPAAAAAAGLLPQHLMA 282
Fly 283 PHYKLPN 289 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
hbn | NP_788420.1 | Homeobox | 156..209 | CDD:278475 | 23/52 (44%) |
RHOXF2B | NP_001093155.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 16..136 | 15/75 (20%) | |
Homeobox | 140..190 | CDD:278475 | 23/49 (47%) | ||
Nuclear localization signal. /evidence=ECO:0000250 | 186..195 | 5/8 (63%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |