DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and Isx

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001281207.1 Gene:Isx / 71597 MGIID:1918847 Length:242 Species:Mus musculus


Alignment Length:227 Identity:76/227 - (33%)
Similarity:95/227 - (41%) Gaps:79/227 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 REDSPTNTDGGLDVDNDDELSSSLNNGHDLSDMERP---------RKVRRSRTTFTTFQLHQLER 170
            :|||...|..|                   |.:|||         :..||.||||||.||.:||:
Mouse    50 KEDSRQTTIPG-------------------SKLERPPQDQPQEEKKNKRRVRTTFTTEQLQELEK 95

  Fly   171 AFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREKFMN------------------- 216
            .|..|.|||:..|..||.|::|.|||||:||||:||||||:||..|                   
Mouse    96 LFHFTHYPDIHVRSQLASRINLPEARVQIWFQNQRAKWRKQEKSGNLSAPQQPGSCADTHCYDYI 160

  Fly   217 ----------QDKAGY-LLP--EQGLPEFPLGIPLPPHGLPGHPGSMQSEFWPPHFALHQHFNPA 268
                      .|.|.: |:|  :...|..|:| |..| ..|.||.|:     .|:  ||.   |.
Mouse   161 GTSHRMLPTLSDSAPFKLVPYTDSPCPMAPMG-PTAP-AWPSHPASL-----CPY--LHV---PT 213

  Fly   269 AAAAAGLLPQHL----MAPHYKLPNFHTLLSQ 296
            .....|   |||    :...:.|....|||||
Mouse   214 PTPQVG---QHLCNFNIGTDFSLSKQATLLSQ 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 32/52 (62%)
IsxNP_001281207.1 Homeobox 82..134 CDD:278475 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.