DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and Rhox4f

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001034785.1 Gene:Rhox4f / 636177 MGIID:3613392 Length:205 Species:Mus musculus


Alignment Length:134 Identity:37/134 - (27%)
Similarity:52/134 - (38%) Gaps:32/134 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 EDSPTNTDGGLDVDN----DDELSSSLNNGHDLSDME---------------------RPRKV-- 153
            |..|...|..| :||    |.:.|.|......|.:..                     ||:.|  
Mouse    63 EGGPAAGDADL-MDNSNQEDQDTSGSAQEEEKLPEEPVLKDAVVIDKVQPIPVLVSGVRPKSVWV 126

  Fly   154 --RRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREK--F 214
              |.....|..:||.:|||.|::..:.....|..||..:.:|||||..||:.||..:|:.:.  .
Mouse   127 QQRSLHYNFQWWQLQELERIFQQNHFIRAEERRHLARWIGVSEARVMTWFKKRREHFRRGQSQLG 191

  Fly   215 MNQD 218
            ||.|
Mouse   192 MNDD 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 19/52 (37%)
Rhox4fNP_001034785.1 P-loop_NTPase 44..>126 CDD:304359 13/63 (21%)
homeodomain 129..187 CDD:238039 21/57 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.