DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment hbn and Rhox4b

DIOPT Version :9

Sequence 1:	NP_788420.1	Gene:	hbn / 47894	FlyBaseID:	FBgn0008636	Length:	409	Species:	Drosophila melanogaster
Sequence 2:	NP_067275.1	Gene:	Rhox4b / 57737	MGIID:	1930129	Length:	205	Species:	Mus musculus

Alignment Length:	134	Identity:	37/134 - (27%)
Similarity:	52/134 - (38%)	Gaps:	32/134 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   116 EDSPTNTDGGLDVDN----DDELSSSLNNGHDLSDME---------------------RPRKV-- 153
            |..|...|..| :||    |.:.|.|......|.:..                     ||:.|
Mouse    63 EGGPAAGDADL-MDNSNQEDQDTSGSAQEEEKLPEEPVLRDAVVIDKVQPIPVLVSGVRPKSVWV 126

  Fly   154 --RRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREK--F 214
              |.....|..:||.:|||.|::..:.....|..||..:.:|||||..||:.||..:|:.:.  .
Mouse   127 QQRSLHYNFQWWQLQELERIFQQNHFIRAEERRHLARWIGVSEARVMTWFKKRREHFRRGQSQLG 191

  Fly   215 MNQD 218
            ||.|
Mouse   192 MNDD 195

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
hbn	NP_788420.1	Homeobox	156..209	CDD:278475	19/52 (37%)
Rhox4b	NP_067275.1	P-loop_NTPase	41..>126	CDD:304359	13/63 (21%)
Rhox4b	NP_067275.1	homeodomain	129..187	CDD:238039	21/57 (37%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910