DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and PROP1

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_006252.4 Gene:PROP1 / 5626 HGNCID:9455 Length:226 Species:Homo sapiens


Alignment Length:152 Identity:66/152 - (43%)
Similarity:75/152 - (49%) Gaps:32/152 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 RPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREK 213
            ||...||.||||:..||.|||.||.:.||||::.||.||....|||||:||||||||||.||:|:
Human    65 RPHSRRRHRTTFSPVQLEQLESAFGRNQYPDIWARESLARDTGLSEARIQVWFQNRRAKQRKQER 129

  Fly   214 FMNQDKA-------GYLLPEQGLPEFPLGIPLPP---------HGLPGHPG-------SMQSEFW 255
            .:.|..|       ...|||.....:....|.||         |.||..|.       |.|||.|
Human   130 SLLQPLAHLSPAAFSSFLPESTACPYSYAAPPPPVTCFPHPYSHALPSQPSTGGAFALSHQSEDW 194

  Fly   256 PPHFALHQHFNPAAAAAAGLLP 277
            .|  .||       .|.||.||
Human   195 YP--TLH-------PAPAGHLP 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 34/52 (65%)
PROP1NP_006252.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75 5/9 (56%)
Homeobox 72..126 CDD:395001 34/53 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..226 8/21 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.