DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and alx4b

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001297007.1 Gene:alx4b / 497424 ZFINID:ZDB-GENE-050208-140 Length:259 Species:Danio rerio


Alignment Length:206 Identity:41/206 - (19%)
Similarity:58/206 - (28%) Gaps:107/206 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 KWRKREKFMNQDKAGYLLPEQGLPEFPLGIPLPPHGLPGHPGSMQSEFWPPHFALHQHFNPAAAA 271
            ||||||:|                                 |.||.        :..||:.|   
Zfish   120 KWRKRERF---------------------------------GQMQQ--------VRTHFSTA--- 140

  Fly   272 AAGLLPQHLMAPHYKLPNFHTLLSQYMGLSNLNGIFGAGAAAAAAAASAGYPQNLSLHAGLSAMS 336
                         |:||    ||::....:.:                    ||.|..:|.|:.|
Zfish   141 -------------YELP----LLTRPENYAQI--------------------QNPSWLSGSSSAS 168

  Fly   337 QVSPPCSNSSPRESPKLVPHPTPPHAT---------PPAGG-------------NGGGGLLTGGL 379
            .| |.|.......|..:.||   ||:.         |..||             :|.||.:.|..
Zfish   169 PV-PGCVVPCDTVSSCMTPH---PHSASGVSDFLGMPSPGGSMAQTHMGSLFGSSGVGGTINGYD 229

  Fly   380 ISTAAQSPNSA 390
            :|......:|:
Zfish   230 LSVEPDRKSSS 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 1/1 (100%)
alx4bNP_001297007.1 OAR 235..252 CDD:281777 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.