DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and Rhox8

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001004193.1 Gene:Rhox8 / 434768 MGIID:3579898 Length:320 Species:Mus musculus


Alignment Length:138 Identity:39/138 - (28%)
Similarity:76/138 - (55%) Gaps:17/138 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 QQQQQHSQQQHHSQQQQQQQQLQVQAKREDSPTNTDGGLDVDNDDELSSSLNNGHD--------- 143
            :::::..:::...:::::::.....|.|:::...:...:|..:.|..:||  ||.|         
Mouse   182 EEEEEEEEEEEEEEEEEEEEAAAAAAARDETTAGSSAPVDDRSHDAGASS--NGEDRGQGEELIP 244

  Fly   144 -----LSDMERPR-KVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQ 202
                 |..:..|. ::.|:|..||.|||.:|||.||:..||....|.:||..:.::|:||:.||:
Mouse   245 GGTKGLEALPSPSGQLPRNRYRFTKFQLQELERIFERNHYPSAAARRELARWIGVTESRVENWFK 309

  Fly   203 NRRAKWRK 210
            :||||:||
Mouse   310 SRRAKYRK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 25/52 (48%)
Rhox8NP_001004193.1 homeodomain 261..317 CDD:238039 26/55 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.