DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and Rhox8

DIOPT Version :10

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001004193.1 Gene:Rhox8 / 434768 MGIID:3579898 Length:320 Species:Mus musculus


Alignment Length:138 Identity:39/138 - (28%)
Similarity:76/138 - (55%) Gaps:17/138 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 QQQQQHSQQQHHSQQQQQQQQLQVQAKREDSPTNTDGGLDVDNDDELSSSLNNGHD--------- 143
            :::::..:::...:::::::.....|.|:::...:...:|..:.|..:||  ||.|         
Mouse   182 EEEEEEEEEEEEEEEEEEEEAAAAAAARDETTAGSSAPVDDRSHDAGASS--NGEDRGQGEELIP 244

  Fly   144 -----LSDMERPR-KVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQ 202
                 |..:..|. ::.|:|..||.|||.:|||.||:..||....|.:||..:.::|:||:.||:
Mouse   245 GGTKGLEALPSPSGQLPRNRYRFTKFQLQELERIFERNHYPSAAARRELARWIGVTESRVENWFK 309

  Fly   203 NRRAKWRK 210
            :||||:||
Mouse   310 SRRAKYRK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeodomain 154..210 CDD:459649 26/55 (47%)
Rhox8NP_001004193.1 Homeodomain 262..317 CDD:459649 26/54 (48%)

Return to query results.
Submit another query.