DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and si:dkey-43p13.5

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_002661267.2 Gene:si:dkey-43p13.5 / 407678 ZFINID:ZDB-GENE-131121-510 Length:315 Species:Danio rerio


Alignment Length:141 Identity:55/141 - (39%)
Similarity:76/141 - (53%) Gaps:17/141 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LSSSLNNGHDLSDMERPR--KVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEAR 196
            |::..::||...:::.||  |.||:|..::::||.:||:.|:.|.|||:|.||.||:||||.|||
Zfish   120 LAAHPSSGHPADNIDEPRPVKQRRARANYSSWQLEELEKTFQSTHYPDIFMREALALRLDLIEAR 184

  Fly   197 VQVWFQNRRAKWRKREKFM-------NQDKAGYLLPEQGL--PEFPLGIPLP------PHGLPGH 246
            |||||||||||.|::.|..       :|.......||..:  ||.....|.|      ....|.|
Zfish   185 VQVWFQNRRAKMRRQLKLQIQTGEQCSQRDTDTRHPESSISNPELHNNSPSPCWDRNQDRTNPAH 249

  Fly   247 PGSMQSEFWPP 257
            |....|....|
Zfish   250 PKPSPSAIQSP 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 33/52 (63%)
si:dkey-43p13.5XP_002661267.2 Homeobox 145..197 CDD:278475 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.