DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and PHDP

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster


Alignment Length:173 Identity:64/173 - (36%)
Similarity:95/173 - (54%) Gaps:35/173 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 HSSNSNG-----SNHLSHQQQQQHSQQQHHSQQQ------QQQQQL---QVQAKREDSPT----- 120
            ::|.:||     :||::|......|..:..:.:.      .|:..|   ::....|..|.     
  Fly    24 YNSGANGGGLSVANHINHYNLMIDSSYKLCANESAIRGSLNQESSLLFSKITTVSEFYPATHNIG 88

  Fly   121 --NTDGGLDVDNDDELSSSLNNGHDLSDMERPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTR 183
              |||..|....||.||        |:|..   |.||.|||||:.||::||:.|.:|.|||::||
  Fly    89 SYNTDFHLKSYGDDGLS--------LTDKS---KQRRIRTTFTSNQLNELEKIFLETHYPDIYTR 142

  Fly   184 EDLAMRLDLSEARVQVWFQNRRAKWRKREK---FMNQDKAGYL 223
            |::|.:|.|:||||||||||||||:||:|:   ::.:||:..|
  Fly   143 EEIASKLHLTEARVQVWFQNRRAKFRKQERHAIYIMKDKSSKL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 34/52 (65%)
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.