DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and Pph13

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster


Alignment Length:242 Identity:82/242 - (33%)
Similarity:109/242 - (45%) Gaps:69/242 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 RKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREKF- 214
            ||.||.||||.|.||.:|||||::|.|||||.||:||:|:||:|||||||||||||||||:||. 
  Fly     8 RKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWRKQEKIG 72

  Fly   215 --------------MNQDKAGYLLPEQGLPEFPLG-----IPLPPHGLPGHPGSMQSEFWPPHFA 260
                          ::.|.:..|    |..:..||     :|..|   |....|:.:|.      
  Fly    73 GLGGDYKEGALDLDVSYDDSAVL----GQLDSALGGGGTLLPDTP---PQSSNSLDNEL------ 124

  Fly   261 LHQHFNPAAAAAAGLLPQHLMAPHYKLPN-FHTLLSQYMGLSNLNGIFGAGAAAAAAAASAGYPQ 324
                   .|:...|     .|:|....|| |..|...::||..       |.:..:...|...||
  Fly   125 -------KASYGTG-----AMSPSRLSPNIFLNLNIDHLGLER-------GGSGLSMEWSTYPPQ 170

  Fly   325 NLSLHAGLSAMSQVSPPCSNSSPRESPKLVPHPTPPHATPP--AGGN 369
                     ..:|..|...:.:     :|..||...||:.|  ||.:
  Fly   171 ---------TQAQTHPQMDSDN-----QLQQHPPQQHASDPIHAGSS 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 39/52 (75%)
Pph13NP_477330.1 Homeobox 14..66 CDD:278475 39/51 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D143142at50557
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.