DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and al

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster


Alignment Length:408 Identity:124/408 - (30%)
Similarity:166/408 - (40%) Gaps:112/408 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LGNQHQIKRSDTPSEVLITHPHHGHPHHIHHLHSSNSNGSNHLSHQQQQQHSQQQHHSQQQQQQQ 107
            :|...:||..:.|.|..:.||.       ..:....:.||:..|.......|             
  Fly     1 MGISEEIKLEELPQEAKLAHPD-------AVVLVDRAPGSSAASAGAALTVS------------- 45

  Fly   108 QLQVQAKREDSPTNTDGGLDVDNDDELSSSLNNGHDLSDMER-----PRKVRRSRTTFTTFQLHQ 167
             :.|........:...||        .:|.:::|:  ||.|.     .||.||.|||||:|||.:
  Fly    46 -MSVSGGAPSGASGASGG--------TNSPVSDGN--SDCEADEYAPKRKQRRYRTTFTSFQLEE 99

  Fly   168 LERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREKFMNQDKAGYLLPEQGLPEF 232
            ||:||.:|.||||||||:|||::.|:|||:|||||||||||||      |:|.|           
  Fly   100 LEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRK------QEKVG----------- 147

  Fly   233 PLGIPLPPHGLPGHPGSMQS---EFWPPH------FALHQHFNPAAAA-----------AAGLLP 277
            |...|..|: |||...:||:   ...||:      |.|.:.|:...||           ||.::|
  Fly   148 PQSHPYNPY-LPGGAATMQTVVGAALPPNPFTHLGFQLRKPFDAQHAANLAAFRYPHLSAAPMIP 211

  Fly   278 -----QHLMAPHYKLPNFHTLLSQYMGLSNLNGIFGAGAAAAAAAASAGYPQNL-----SLHAGL 332
                 |...||.:.||  |.:...|...|:...:. |...|.......|.|..|     .||:..
  Fly   212 SGYFNQFQRAPPHMLP--HGMAGMYSPSSSFQSLL-ANMTAVPRGTPLGKPPALLVGSPDLHSPN 273

  Fly   333 SAMSQVSPPCSNSSPRESPKL---VPHPTPPHATP--PAGGNGGGGLLTGGLISTAAQSPNSAAG 392
            ..::  |||.|.:|...|...   ..||.||.|.|  |.|            :..|..||....|
  Fly   274 HMLA--SPPTSPASGHASQHQQHPTAHPPPPQAPPQMPVG------------VQPAQLSPQHLVG 324

  Fly   393 ------ASSNASTPVSVV 404
                  |||.:.|..|.|
  Fly   325 IALTQQASSLSPTQTSPV 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 38/52 (73%)
alNP_722629.1 Homeobox 89..141 CDD:278475 38/51 (75%)
OAR 374..391 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D143142at50557
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3639
66.020

Return to query results.
Submit another query.