DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and OdsH

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster


Alignment Length:163 Identity:60/163 - (36%)
Similarity:86/163 - (52%) Gaps:19/163 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LSHQQQQQHSQQQHHSQQQQQQQQLQVQAKREDSPTN-----TDGGLDVD--NDDELSSSLNNGH 142
            :..|||||....:........:|::::.:.   |||:     :..|:..|  :|:...|:|..  
  Fly    90 MQQQQQQQRDLNRELGMDPHSEQRIKLDSV---SPTHNIHAGSSRGIKQDPLSDEGADSNLGQ-- 149

  Fly   143 DLSDMERPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAK 207
              :|.....|.||.||.|.::||.:|||.|:.:.|||:|.||.||.:|||.|.|:.|||||||||
  Fly   150 --NDCTESSKKRRGRTNFNSWQLRELERVFQGSHYPDIFMREALATKLDLMEGRIAVWFQNRRAK 212

  Fly   208 WRKREKFMNQDKAGYLLPEQGL-PEFPLGIPLP 239
            |||:|    ..|.|...|.... |:...|.|:|
  Fly   213 WRKQE----HTKKGPGRPAHNAHPQSCSGDPIP 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 31/52 (60%)
OdsHNP_523389.3 Homeobox 162..214 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5708
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.