DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and CG11294

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001259352.1 Gene:CG11294 / 31807 FlyBaseID:FBgn0030058 Length:261 Species:Drosophila melanogaster


Alignment Length:260 Identity:79/260 - (30%)
Similarity:100/260 - (38%) Gaps:60/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 RKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREKF- 214
            |:.||:|||||..||.:||..|:||.|||||.||::|:|:.|||||||||||||||||||:.:. 
  Fly    22 RRQRRNRTTFTPQQLQELEALFQKTHYPDVFLREEVALRISLSEARVQVWFQNRRAKWRKQARLQ 86

  Fly   215 MNQDKAGYLLPEQGLPEFPLG-----------IPLPPHGLPGHPGSMQSE--------------F 254
            :.||.........|.|....|           ...||...|.:..|...:              |
  Fly    87 LLQDAWRMRCLSLGTPPVMGGGAVQGGSGNGATARPPSQTPENLSSASKDSELAEVGNGPNSGSF 151

  Fly   255 WPPHFALHQHFNPAAAAAAGLLPQHLMAPHY---------KLPNFHTLLSQYMGLSNLNGIFGAG 310
            ...|.|..|              ||....|.         ||...:|.|..|...|:       |
  Fly   152 TMMHPAFQQ--------------QHQQQQHQGHQQATDQDKLSKTYTELKLYKAPSH-------G 195

  Fly   311 AAAAAAAASAGYPQNLSLHAGLSAMSQVSPPCSNSSPRESPKLVPHPTPPHATPPAGG----NGG 371
            ......||.:|:....|..:....:...|..|.:.|.....:..........|..|.|    |||
  Fly   196 MELGGMAALSGHSDEGSDGSDSEEIDLTSGACIDFSQSSKLQQQQQQQQQQGTQGAAGSAEANGG 260

  Fly   372  371
              Fly   261  260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 37/52 (71%)
CG11294NP_001259352.1 Homeobox 29..80 CDD:278475 36/50 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.