DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and rx2

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_571301.2 Gene:rx2 / 30473 ZFINID:ZDB-GENE-990415-237 Length:327 Species:Danio rerio


Alignment Length:282 Identity:97/282 - (34%)
Similarity:132/282 - (46%) Gaps:62/282 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VYSIDQILGNQHQIKRSDTPSEVLITHPHHGHPHHIHHLHSSNSNGSNHLSHQQQQQHSQQQHHS 100
            |:|||.|||..   |..|...|.:.||                ....:.|..|::|.:|....|.
Zfish    36 VHSIDVILGFS---KDQDPLLEPIGTH----------------KVDEDQLEEQEKQVNSDPYSHL 81

  Fly   101 Q---QQQQQQQLQVQAKREDSPTNTDGGLDVDNDDELSS--SLNNGHDLSDMERPRKV-RRSRTT 159
            |   |.||||.:.     .|:...:....|.|..|..|:  |.:...|:.|.::|:|. ||:|||
Zfish    82 QIPDQTQQQQSVY-----HDTGLFSTDKCDADLGDPRSNVESDSRSPDIPDEDQPKKKHRRNRTT 141

  Fly   160 FTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREKFMNQDKAGYLL 224
            |||:|||:|||||||:.||||::||:|||:::|.|.||||||||||||||::||   .|.....|
Zfish   142 FTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEK---MDTGTMKL 203

  Fly   225 PEQGLPEF------------------------PLGIPLPPHGLPGHPGSMQSEFWPPHFALHQHF 265
            .:..:..|                        ||....|.|.:||..|..||  ..|.:..|..|
Zfish   204 HDSPIRSFNRPPMAPNVGPMSNSLPLDPWLSSPLSSATPMHSIPGFMGPGQS--LQPTYTAHPGF 266

  Fly   266 -NPAAAAAAGLLPQHLMAPHYK 286
             |.:......:.|  :..|.|:
Zfish   267 LNTSPGMMQNMQP--MPPPPYQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 39/52 (75%)
rx2NP_571301.2 Octapeptide motif 37..44 4/6 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..73 6/40 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..139 11/38 (29%)
Homeobox 139..191 CDD:278475 39/51 (76%)
OAR 302..316 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 304..317
Nuclear localization signal. /evidence=ECO:0000255 310..314
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.