DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and rx1

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_571300.2 Gene:rx1 / 30472 ZFINID:ZDB-GENE-990415-236 Length:330 Species:Danio rerio


Alignment Length:292 Identity:96/292 - (32%)
Similarity:132/292 - (45%) Gaps:77/292 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VYSIDQILG-NQHQIKRSDTPSEVLITHPHHGHPHHIHHLHSSNSNGSNHLSHQ-QQQQHSQQQH 98
            |:|||.||| |:.|                          .|..:.|:|.::|: ..:...:...
Zfish    36 VHSIDVILGFNKDQ--------------------------DSLLNPGANAVAHKVGGESLGEPGK 74

  Fly    99 HSQQQQQQQQLQVQAKREDSPTNTDGGL-----DVDNDD--ELSSSLNNGHDLSDMERPRKV-RR 155
            ..|:.|....|.......:.||..|..:     |.|..|  :...|.:...|.:|.|:|:|. ||
Zfish    75 LDQRVQPYGHLPPLRDGSEQPTFHDADMFSNKCDGDLGDLRKAIESDSKSPDSADGEQPKKKHRR 139

  Fly   156 SRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREKF------ 214
            :||||||:|||:|||||||:.||||::||:|||:::|.|.||||||||||||||::||.      
Zfish   140 NRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVWFQNRRAKWRRQEKIDASTMK 204

  Fly   215 --------------------MNQDKAGYLLP-EQGLPEFPLGIPLPPHGLPGHPGSMQ--SEFWP 256
                                ||..     || :..||. ||....|.|.:||..|..|  ...:|
Zfish   205 LHDSPMLSFNRPSMHPTVGPMNNS-----LPLDPWLPS-PLSSATPVHSIPGFMGPTQGLQTGYP 263

  Fly   257 PHFALHQHFNPAAAAAAGLLPQHLMAPHYKLP 288
            .|..|    :|....|..:.|  :..|.|:.|
Zfish   264 GHSFL----SPPQPMAQSMQP--MAPPPYQCP 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 39/52 (75%)
rx1NP_571300.2 Octapeptide motif 37..44 4/6 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..104 6/37 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..142 8/23 (35%)
Homeobox 141..193 CDD:278475 39/51 (76%)
OAR 302..318 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319
Nuclear localization signal. /evidence=ECO:0000255 312..316
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.