DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and Rhox11

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001020044.1 Gene:Rhox11 / 298346 RGDID:1564332 Length:215 Species:Rattus norvegicus


Alignment Length:215 Identity:51/215 - (23%)
Similarity:82/215 - (38%) Gaps:80/215 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 QQQLQVQAKREDSPTNTDGGLDVDNDDELSSSLNNG-------H-----DLSDME----RPRKVR 154
            ::::..:.:...:.|...||...:..|.|...|..|       |     |:|:::    .|.:.|
  Rat    19 EEEITTEPQERVAYTANKGGFTDEVTDLLKELLYQGGRSTIVEHSYRGCDMSNIQDTEHEPEETR 83

  Fly   155 RSRTT--------------FTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRR 205
            .:..|              ||..||.:::..||:|||||.|.|::||..:::.|.:|:.||.|:|
  Rat    84 NADETSEQLLFRIPRKPYKFTPGQLWEMQAVFEETQYPDAFRRKELAELMNVDEQKVKDWFNNKR 148

  Fly   206 AKWRK------------------REKFMNQDKAGYLLPEQ---GLPEFPLGIPLPPHGLPGHPGS 249
            ||.||                  |.|.:.:.|...:..||   ||                    
  Rat   149 AKLRKIQREILKGKIITPTQDELRMKTLVESKNVIIFQEQVGDGL-------------------- 193

  Fly   250 MQSEFWPPHFALHQHFNPAA 269
                ||.     ||:|:..|
  Rat   194 ----FWD-----HQNFDTRA 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 24/66 (36%)
Rhox11NP_001020044.1 homeodomain 97..155 CDD:238039 25/57 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.