DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and ALX3

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_006483.2 Gene:ALX3 / 257 HGNCID:449 Length:343 Species:Homo sapiens


Alignment Length:388 Identity:106/388 - (27%)
Similarity:153/388 - (39%) Gaps:100/388 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QHHPIMPPAMRPAPVQESPVSRPRAVYSIDQILGNQHQIKRSDTPSEVLITHPHHGHPHHIHHLH 75
            |..|...|.:.|||.:...::|..|.                 .|.|..:..|......::..|.
Human    29 QGTPAAAPHLHPAPPRGPRLTRFPAC-----------------GPLEPYLPEPAKPPAKYLQDLG 76

  Fly    76 SSNSNGSNHLSHQQQQQHSQQQHHSQQQQQQQQLQVQAKREDSPTNTDG-------GLDVDNDDE 133
            ...:....|.  .:....::::........|..|..:....|.|:|..|       .|.:    .
Human    77 PGPALNGGHF--YEGPAEAEEKTSKAASFPQLPLDCRGGPRDGPSNLQGSPGPCLASLHL----P 135

  Fly   134 LSSSLNNGHDLSDMERPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQ 198
            ||..|.:..:|:  :...|.||:||||:||||.:||:.|:||.||||:.||.||:|.||:|||||
Human   136 LSPGLPDSMELA--KNKSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQ 198

  Fly   199 VWFQNRRAKWRKREKF------MNQDKAGY---LLPEQGLPEFPLGIPLPPHGLPGHPGSMQSEF 254
            ||||||||||||||::      .|...|.|   :||.                ...|| .:|:..
Human   199 VWFQNRRAKWRKRERYGKIQEGRNPFTAAYDISVLPR----------------TDSHP-QLQNSL 246

  Fly   255 WPPHFALHQHFNPAAAAAAGL-------LPQHLMAPHYKLPNFHTLLSQYMGLSNLNGIFGAGAA 312
            |.         :|.:.:..|.       :|...|:| |..|  |..::.:||:            
Human   247 WA---------SPGSGSPGGPCLVSPEGIPSPCMSP-YSHP--HGSVAGFMGV------------ 287

  Fly   313 AAAAAASAGYPQNLSLHAGLSAMSQVSPPCSNSSPRESPKLVPHPTPPHATPPAGGNGGGGLL 375
               .|.||.:|...|:|.....:...|...|:....:||.||.....|...|        |||
Human   288 ---PAPSAAHPGIYSIHGFPPTLGGHSFEPSSDGDYKSPSLVSLRVKPKEPP--------GLL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 38/52 (73%)
ALX3NP_006483.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104 13/93 (14%)
PRK12323 <13..131 CDD:237057 19/120 (16%)
Homeobox 157..210 CDD:365835 39/52 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.