DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and Alx1

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_037053.1 Gene:Alx1 / 25401 RGDID:2273 Length:326 Species:Rattus norvegicus


Alignment Length:240 Identity:77/240 - (32%)
Similarity:109/240 - (45%) Gaps:54/240 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 QHHSQQQQQQ--QQLQVQ---AKREDSPTNTDGGLDVDNDDEL----------SSSLNNGHDLSD 146
            :||.:..:..  |...|.   .|.|..|.:|:....:|..:.|          .|.|:...|..|
  Rat    60 EHHVRLDRTSPCQDSSVNYGITKVEGQPLHTELNRAMDGCNNLRMSPVKGMPEKSELDELGDKCD 124

  Fly   147 ME-RPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRK 210
            .. ...|.||.|||||:.||.:||:.|:||.||||:.||.||:|.:|:|||||||||||||||||
  Rat   125 SNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRK 189

  Fly   211 REKF--MNQDKAGY-------LLPEQGLPEFPLGIPLPPHGLPGHPGSMQSEFWPPHFALHQHFN 266
            ||::  :.|.|:.:       :||.  ...:|               .:|:..|.      .:.:
  Rat   190 RERYGQIQQAKSHFAATYDISVLPR--TDSYP---------------QIQNNLWA------GNTS 231

  Fly   267 PAAAAAAGLLPQ---HLMAPHYKLPNFHTLLSQYMGLSNLNGIFG 308
            ..:...:.:||:   ..|.|:...|...   |.|.|.||....||
  Rat   232 GGSVVTSCMLPRDASSCMTPYSHSPRTD---SSYTGFSNHQNQFG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 36/52 (69%)
Alx1NP_037053.1 Homeobox 135..188 CDD:278475 36/52 (69%)
Transactivation domain. /evidence=ECO:0000269|PubMed:12390248 192..326 19/108 (18%)
OAR 302..319 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.