DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and Nkx1-2

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_033149.1 Gene:Nkx1-2 / 20231 MGIID:104806 Length:305 Species:Mus musculus


Alignment Length:233 Identity:69/233 - (29%)
Similarity:103/233 - (44%) Gaps:49/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SHQQQQQHSQQQHHSQQQQQQQQLQVQAKREDSPTNTDGGLDVDNDDELSSSLNNGHDLSDMERP 150
            |..::::.::....:.|.::.|.:     .|.||...  .:.|..::..:..|..........||
Mouse    87 SEAEEEEEAEDAGRAHQPERWQGV-----HEGSPEAR--AVAVGTEESGAEGLPASPGSPGSPRP 144

  Fly   151 R---------KVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRA 206
            |         |.||:||.||..||..||..|..|:|..|..|.:||:.|.|:|.:|::||||||.
Mouse   145 RRRRAESSCAKPRRARTAFTYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIWFQNRRT 209

  Fly   207 KWRKREKFMNQD---KAGYLLPEQGLPEFPLG--------IPLPPHGLPGHPGSMQSEFWPPHFA 260
            ||:|:..  ..|   :||...|:.|.|....|        .|.||     .||::..:.:|.:.|
Mouse   210 KWKKQNP--GADGAVQAGGGAPQPGTPGAVAGGGGSATGSSPGPP-----VPGALPYQTFPTYPA 267

  Fly   261 LHQHFNPAAA-----AAAG------LLPQHL---MAPH 284
            .:..| |||:     ||.|      |.|.:|   .|||
Mouse   268 TNVLF-PAASFPLTTAANGSPFTPFLGPSYLTPFYAPH 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 26/52 (50%)
Nkx1-2NP_033149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..158 12/77 (16%)
Homeobox 160..212 CDD:278475 26/51 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..257 15/53 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.