DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and Rax

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_038861.2 Gene:Rax / 19434 MGIID:109632 Length:342 Species:Mus musculus


Alignment Length:240 Identity:85/240 - (35%)
Similarity:107/240 - (44%) Gaps:72/240 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 LSDMERPRKV-RRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAK 207
            ||:.|.|:|. ||:||||||:|||:|||||||:.||||::||:||.:::|.|.||||||||||||
Mouse   126 LSEEEPPKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAGKVNLPEVRVQVWFQNRRAK 190

  Fly   208 WRKREKFMNQDKAGYLLPEQGLPEF----------PLGIPLPPHGLPGHPGS-MQSEFW--PPHF 259
            ||::||.   :.:...|.:..|..|          |||  ..|....|.||| :..|.|  ||  
Mouse   191 WRRQEKL---EVSSMKLQDSPLLSFSRSPPSSALAPLG--TGPGSGSGPPGSALPLEPWLGPP-- 248

  Fly   260 ALHQHFNPAAAAAAGLLPQHLMAPHYKLPNFHTLLSQYMGLSNLNGIFGAGAAAAAAAASAGYPQ 324
                                       ||                   |.||.|..:....|.|.
Mouse   249 ---------------------------LP-------------------GGGATALQSLPGFGPPG 267

  Fly   325 NLSLHAGLSAMSQVSPPCSNSSPRESPKLVPHPTPPHATPPAGGN 369
            .     ||.|.....||..||:|.........|.|.:...||.|:
Mouse   268 Q-----GLPASYTPPPPFLNSAPLGPGLQQLGPPPAYPCAPAFGD 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 38/52 (73%)
RaxNP_038861.2 Octapeptide motif 33..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..140 7/13 (54%)
Homeobox 140..192 CDD:278475 38/51 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..295 30/141 (21%)
OAR 316..331 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 319..332
Nuclear localization signal. /evidence=ECO:0000255 325..329
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.