DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and ceh-8

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_492246.2 Gene:ceh-8 / 191617 WormBaseID:WBGene00000433 Length:276 Species:Caenorhabditis elegans


Alignment Length:274 Identity:84/274 - (30%)
Similarity:118/274 - (43%) Gaps:62/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PTNTDGGLDVDNDDELSSSLNNGHD-LSDMERPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFT 182
            |:::....:.|:....|||.....| ::|    :|.||:||||||||||.||.||:||.||||:.
 Worm    29 PSDSFSSFESDSSPSKSSSSRKNRDKIAD----KKQRRNRTTFTTFQLHALEAAFDKTHYPDVYA 89

  Fly   183 REDLAMRLDLSEARVQVWFQNRRAKWRKREKFMNQDKAGYLLPEQGLPEF-----------PLGI 236
            ||.||.::.|.|.||||||||||||:|::||...|.:..:.|.:. :|.:           |:  
 Worm    90 RETLAAKVQLPEVRVQVWFQNRRAKFRRQEKQDCQGEEKHSLKDT-MPSWSWMSENKTDTPPM-- 151

  Fly   237 PLPPHGL--PGHPGSMQSEFWPPHFALHQHFNPAAAAAAGLLPQHLMAPHYKLPNFHTLLSQYMG 299
             |||...  ..|...:..||:........:..|.|              .|..|..:|.:|:...
 Worm   152 -LPPANTLSSTHNNGISDEFFKTSEGKEVYGFPFA--------------EYGTPADNTHVSKTGN 201

  Fly   300 LSNLNGIFGAGAAAAAAAASAGYPQNLSLHAGLSAMSQVSPP-------------CSNSSPRESP 351
            :.:||  |......:....|...|...|     ..:|:..||             ..|..|    
 Worm   202 VFHLN--FEDSDKKSMKKESPQTPSTSS-----PFISEYHPPFIPYYIPNQSFSNAFNQYP---- 255

  Fly   352 KLVPHPTPPHATPP 365
              :|.|.|.|..||
 Worm   256 --MPFPYPIHFEPP 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 38/52 (73%)
ceh-8NP_492246.2 Homeobox 64..116 CDD:278475 38/51 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.980

Return to query results.
Submit another query.