DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and Prop1

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_032962.1 Gene:Prop1 / 19127 MGIID:109330 Length:223 Species:Mus musculus


Alignment Length:216 Identity:78/216 - (36%)
Similarity:97/216 - (44%) Gaps:46/216 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SQQQHHSQQQQQQQQLQVQAKREDSPTNTDGGL--DVDNDDELSSSLNNGHDLS------DMERP 150
            :|::.|   |::|.:.....:....|....|.|  .||...|....| :|.:|.      ...||
Mouse     3 AQRRSH---QEKQTKGHACGRSLPEPRVASGTLISTVDRSSEAYRRL-SGTELGRPKLCPQRGRP 63

  Fly   151 RKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREKFM 215
            ...||.||||...||.|||.||.:.||||::.||.||....|||||:||||||||||.||:|:.:
Mouse    64 HSRRRHRTTFNPAQLEQLESAFGRNQYPDIWAREGLAQDTGLSEARIQVWFQNRRAKQRKQERSL 128

  Fly   216 NQDKA--------GYLLPEQGLPEFPLGIPLPP---------HGLPGHPGSM-------QSEFWP 256
            .|..|        |: |||.....:..|.|.||         |.||..|.:.       |.|.|.
Mouse   129 LQPIAHLSTATFSGF-LPESSAYPYTYGTPPPPAPCFPHPYSHSLPSQPSTAASLALPPQPEDWY 192

  Fly   257 PHFALHQHFNPAAAAAAGLLP 277
            |  .||       .|..|.||
Mouse   193 P--TLH-------PAPTGHLP 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 34/52 (65%)
Prop1NP_032962.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 16/69 (23%)
Homeobox 69..122 CDD:278475 34/52 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 168..223 14/46 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.