DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and ceh-53

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_500361.3 Gene:ceh-53 / 182467 WormBaseID:WBGene00015651 Length:203 Species:Caenorhabditis elegans


Alignment Length:234 Identity:72/234 - (30%)
Similarity:93/234 - (39%) Gaps:63/234 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 QQQQQLQVQAKR-EDSPTNTDGGLDVDNDDELSSSLNNGHDLSDMERPRKVRRSRTTFTTFQLHQ 167
            |...|.|:..|. ..||..:     ..|.:|                 |:|||.||.|:..||..
 Worm     3 QSPMQFQMVMKECSSSPPQS-----AQNSEE-----------------RRVRRLRTAFSENQLEL 45

  Fly   168 LERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREKFMNQDKAGYL--LPEQGLP 230
            ||.||.|.|||||..||.|..:.:|:|||:||||:|||||.|||::..:.|.....  ..|:|..
 Worm    46 LEEAFLKCQYPDVQQRETLGKQTELAEARIQVWFKNRRAKARKRQRNESTDSCSTTEESNEEGDA 110

  Fly   231 EFPLGIPLPPHGLPGHPGSMQSE--------FWPPHFALHQHFNPAAAAAAGLLPQHLMAPHYKL 287
            :                |.::.:        .|.|..||   ||      :.|.|.....|....
 Worm   111 D----------------GCLKKKAKNETTIITWTPGAAL---FN------SSLSPTTTSIPTTPA 150

  Fly   288 PNFHTLLSQ-----YMGLSNLNGIFGAGAAAAAAAASAG 321
            |..:.:..|     |....|||.|.....||...|||.|
 Worm   151 PPLNFICHQNPFYAYNPYRNLNTIPTHLLAATTTAASIG 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 31/52 (60%)
ceh-53NP_500361.3 Homeobox 35..81 CDD:365835 26/45 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.