DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and dsc-1

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_510497.1 Gene:dsc-1 / 181599 WormBaseID:WBGene00001096 Length:310 Species:Caenorhabditis elegans


Alignment Length:250 Identity:66/250 - (26%)
Similarity:101/250 - (40%) Gaps:55/250 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LGNQHQIKRSDTPSEVLITHPHHGHPHHIHHLHSSNSNGS-------NHLSHQQQQQHSQQQHHS 100
            :.|||.:...|.|:.|             ..:.|::..|.       :|:.:|.....|...:.:
 Worm    87 MSNQHYLSDFDCPTTV-------------SPISSAHETGQLPQLSPYDHIGNQDPHMFSPHAYGN 138

  Fly   101 QQQQQQQQLQVQAKREDSPTNTDGGLDVDNDDELSSSLNNGHDLSDMERPRKVRRSRTTFTTFQL 165
            .........: .|.|..|..|.  |....|...:||  :|.......      ||.||.||..|.
 Worm   139 SMIPDNSYFE-NASRSISAPNV--GNSTLNPSLMSS--DNAQSCGGR------RRFRTNFTELQS 192

  Fly   166 HQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRK-----REKFMNQDKAG---- 221
            ..||.:|:::.|||...::.:|..|.:.|.|:.|||||||||||:     |::..|:..:|    
 Worm   193 TFLEDSFKESHYPDHKAKKYMADFLKIPEDRITVWFQNRRAKWRRKEHRQRDRTRNESFSGGSNS 257

  Fly   222 -------YLLPEQGLP--EFP--LGIPLPPHGLPGHPGSMQSEFWPPHF-ALHQH 264
                   ...|:.| |  :.|  .|||..|..|...|.:.:.:|  |.| :|.:|
 Worm   258 FDFACFSAQHPDDG-PNAKHPNSFGIPNQPMSLDQFPMNTEQDF--PEFPSLQEH 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 24/52 (46%)
dsc-1NP_510497.1 Homeobox 184..236 CDD:278475 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.