DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and unc-4

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_496138.1 Gene:unc-4 / 174544 WormBaseID:WBGene00006744 Length:252 Species:Caenorhabditis elegans


Alignment Length:183 Identity:71/183 - (38%)
Similarity:91/183 - (49%) Gaps:44/183 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 AKREDSPTNTDGGLDVDNDDELSSSLNNGHDLSDMERPRKVRRSRTTFTTFQLHQLERAFEKTQY 177
            :.||.|.:..|..|.::.||.:  :|.:.:|..  |...|.||:||.|:.:||.:||.|||.:.|
 Worm    52 SSREQSTSPDDDNLLMNEDDGI--ALEDDNDTG--ESAAKRRRTRTNFSGWQLEELESAFEASHY 112

  Fly   178 PDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREKFMN-----QDKAGYLLPEQGLPEFPLG-- 235
            ||||.||.|||||||.|:|||||||||||||||||:..|     :...|..:..:.||.||..  
 Worm   113 PDVFMREALAMRLDLLESRVQVWFQNRRAKWRKREQNRNGSSEIKKDDGEQMETKALPTFPFSID 177

  Fly   236 -------------------------------IPLPPHGLPGHPGSMQSEFWPP 257
                                           |||.|...||  |::..|..||
 Worm   178 SILAVSRVPRGRRPNAKYPRVQACKNLSPFMIPLFPITQPG--GNVIREKSPP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 37/52 (71%)
unc-4NP_496138.1 COG5576 <79..186 CDD:227863 53/108 (49%)
Homeobox 91..144 CDD:278475 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5708
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.