DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and ceh-17

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_491393.1 Gene:ceh-17 / 172059 WormBaseID:WBGene00000440 Length:237 Species:Caenorhabditis elegans


Alignment Length:192 Identity:72/192 - (37%)
Similarity:98/192 - (51%) Gaps:41/192 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PSEVLITHPHHGHPHHIHHLH-----------------SSNSNGSNHLSHQQQQQHSQQQHHSQQ 102
            ||.|..:..:....|:|:|.:                 ||:|.|::..|......:....|.|.|
 Worm    26 PSAVTNSFFYTPQSHNIYHQYATPYLQSGRALTTAHNTSSSSAGNSTSSSSSSSNYRNTTHDSLQ 90

  Fly   103 QQQQQQLQVQAKRED----------SPTNTDGGLDVDNDDELSSSL------NNGHDLSDMERPR 151
            ......||.|..::.          :.:|...||.       .|||      ..|..|:..|| |
 Worm    91 AFFNTGLQYQLYQKSQLIGSDTIQRTSSNVLNGLP-------RSSLVGALCSTGGAPLNPAER-R 147

  Fly   152 KVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREK 213
            |.||.|||||:.||.:|||:|.:|.|||::|||::|||:||:||||||||||||||:||:||
 Worm   148 KQRRIRTTFTSGQLKELERSFCETHYPDIYTREEIAMRIDLTEARVQVWFQNRRAKYRKQEK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 37/52 (71%)
ceh-17NP_491393.1 DLL_N 20..112 CDD:403572 17/85 (20%)
Homeobox 153..206 CDD:395001 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.