powered by:
Protein Alignment hbn and ceh-45
DIOPT Version :9
Sequence 1: | NP_788420.1 |
Gene: | hbn / 47894 |
FlyBaseID: | FBgn0008636 |
Length: | 409 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_490823.1 |
Gene: | ceh-45 / 171689 |
WormBaseID: | WBGene00022837 |
Length: | 229 |
Species: | Caenorhabditis elegans |
Alignment Length: | 63 |
Identity: | 35/63 - (55%) |
Similarity: | 45/63 - (71%) |
Gaps: | 0/63 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 151 RKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREK 213
|:.||.||.|:..||:.||..|..|.|||..|||:||::..|.|.||:|||:|||||.||::|
Worm 107 RRKRRHRTIFSEEQLNILETTFSTTHYPDATTREELAVQCSLKEERVEVWFKNRRAKERKQKK 169
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000011 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.