DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and ARX

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_620689.1 Gene:ARX / 170302 HGNCID:18060 Length:562 Species:Homo sapiens


Alignment Length:307 Identity:106/307 - (34%)
Similarity:139/307 - (45%) Gaps:80/307 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 PTNTDGGLDVDNDDELSSSLNNGHDLSDMERPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTR 183
            |.:.:|     .|.|.|..|:.|.|..:....||.||.|||||::||.:|||||:||.|||||||
Human   299 PEDAEG-----KDGEDSVCLSAGSDSEEGLLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTR 358

  Fly   184 EDLAMRLDLSEARVQVWFQNRRAKWRKREKFMNQDKAGYLLPEQGLPEFPLGIPLPPHGLPGHPG 248
            |:|||||||:||||||||||||||||||||             .|....|.|:|.|......||.
Human   359 EELAMRLDLTEARVQVWFQNRRAKWRKREK-------------AGAQTHPPGLPFPGPLSATHPL 410

  Fly   249 S--MQSEFWPPHF-ALHQHFNPAAAAAAGLLPQHLMAPHYKLPNFHTLLSQYMGLSNLNGIFGAG 310
            |  :.:..:|||. ||...:..||||||...|.....|                           
Human   411 SPYLDASPFPPHHPALDSAWTAAAAAAAAAFPSLPPPP--------------------------- 448

  Fly   311 AAAAAAAASAGYPQNLSLHAGLSAMSQ---VSP----------PCSNSSPRESPKLVPHPTPPHA 362
              .:|:...:|.|..||...|.:....   :||          |.:::|  .:..|:..|||   
Human   449 --GSASLPPSGAPLGLSTFLGAAVFRHPAFISPAFGRLFSTMAPLTSAS--TAAALLRQPTP--- 506

  Fly   363 TPPAGGNGGGGLLTGGLISTAAQSPNSAAGASSNASTPVSVVTKGED 409
                       .:.|.:.|.|...|.:|| |...||:..::..|.::
Human   507 -----------AVEGAVASGALADPATAA-ADRRASSIAALRLKAKE 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 43/52 (83%)
ARXNP_620689.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..81
GCG-encoded polyalanine repeat 102..111
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..255
Homeobox 332..385 CDD:395001 44/52 (85%)
OAR 526..544 CDD:397759 3/16 (19%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 530..543 2/12 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3639
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.