DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and Phox2a

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_032913.1 Gene:Phox2a / 11859 MGIID:106633 Length:280 Species:Mus musculus


Alignment Length:286 Identity:81/286 - (28%)
Similarity:102/286 - (35%) Gaps:133/286 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 SDMERPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWR 209
            |.:...||.||.|||||:.||.:|||.|.:|.|||::|||:||:::||:||||||||||||||:|
Mouse    82 SGLHEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFR 146

  Fly   210 KREKFMNQDKAGYLLPEQGLPEFPLGIPLPPHGLPGHPGSMQSEFWPPHFALHQHFNPAAAAAAG 274
            |:|:                                                       ||:|.|
Mouse   147 KQER-------------------------------------------------------AASAKG 156

  Fly   275 LLPQHLMAPHYKLPNFHTLLSQYMGLSNLNGIFGAGAAAAAAAASAGYPQNLSLHAGLSAMSQVS 339
                                                 ||.|..|..| ....|.....|..|..|
Mouse   157 -------------------------------------AAGATGAKKG-EARCSSEDDDSKESTCS 183

  Fly   340 P-PCSNSS-------PRESPKLVPHPTP------PHATPPAG-------GNGGGGLLTG------ 377
            | |.|.:|       ...||:|.|.|.|      |...|..|       |.||||..||      
Mouse   184 PTPDSTASLPPPPAPSLASPRLSPSPLPAALGSGPGPQPLKGALWAGVAGGGGGGPGTGAAELLK 248

  Fly   378 -------------GLISTAAQSPNSA 390
                         |::|:..:.|..|
Mouse   249 AWQPAEPGPGPFSGVLSSFHRKPGPA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 36/52 (69%)
Phox2aNP_032913.1 Homeobox 94..147 CDD:395001 36/52 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..244 36/191 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..280 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.