DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and Alx4

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_031468.1 Gene:Alx4 / 11695 MGIID:108359 Length:399 Species:Mus musculus


Alignment Length:271 Identity:85/271 - (31%)
Similarity:108/271 - (39%) Gaps:102/271 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 DELSSSLNNGHDLSDMERPR-KVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEA 195
            |..|:.:.:..:.:|.|..: |.||:|||||::||.:||:.|:||.||||:.||.||||.||:||
Mouse   180 DRASAEIPSPLEKTDSESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEA 244

  Fly   196 RVQVWFQNRRAKWRKREKFMNQDKAGYLLPEQGLPEFPLGIPLPPHGLPGHPGSMQSEFWPPHFA 260
            |||||||||||||||||:|                                 |.||.        
Mouse   245 RVQVWFQNRRAKWRKRERF---------------------------------GQMQQ-------- 268

  Fly   261 LHQHFNPAAAAAAGLLPQHLMAPHYKLPNFHTLLSQYMGLSNLNGIFGAGAAAAAAAASAGYPQN 325
            :..||:.|                |:|| ..|....|..:.|.:.|...|||:...|...     
Mouse   269 VRTHFSTA----------------YELP-LLTRAENYAQIQNPSWIGNNGAASPVPACVV----- 311

  Fly   326 LSLHAGLSAMSQVSPPCSNSSPRESPKLVPHPTPPHATPPAGG----------NGGGGLL----T 376
                           ||..         ||....|||.||..|          :|.|..:    .
Mouse   312 ---------------PCDP---------VPACMSPHAHPPGSGASSVSDFLSVSGAGSHVGQTHM 352

  Fly   377 GGLISTAAQSP 387
            |.|...|..||
Mouse   353 GSLFGAAGISP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 38/52 (73%)
Alx4NP_031468.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..133
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..206 7/25 (28%)
Homeobox 206..258 CDD:278475 38/51 (75%)
OAR 375..392 CDD:281777
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 379..392
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.