DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and Prrxl1

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_006518472.1 Gene:Prrxl1 / 107751 MGIID:2148204 Length:354 Species:Mus musculus


Alignment Length:240 Identity:81/240 - (33%)
Similarity:108/240 - (45%) Gaps:27/240 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 DLSDMERPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAK 207
            |..|....||.||:|||||..||..||..|.:|.||||||||:|||:::|:||||||||||||||
Mouse   114 DFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFTREELAMKINLTEARVQVWFQNRRAK 178

  Fly   208 WRKREKFMNQDKAGYLLPEQGLPEFPL-GIPLPPHGLPGHPGSMQSEFWPPHFALHQHFNPAAAA 271
            |||.|:..:..:.|...|...:...|: .|..||   ||.....:.|......:|.:...|....
Mouse   179 WRKTERGASDQEPGAKEPMAEVTPPPVRNINSPP---PGDQTRSKKEALEAQQSLGRTVGPTGPF 240

  Fly   272 AAGLLPQHLMAPHYKLPNFHTLLSQY----------------MGLSNLNGIFGAGAAAAAAAASA 320
            ....||..|:    ....:...||..                ||||.| ..:|..:...|:.|:.
Mouse   241 FPSCLPGTLL----NTATYAQALSHVASLKGGPLCSCCVPDPMGLSFL-PTYGCQSNRTASVAAL 300

  Fly   321 GYPQNLSLHAGLSAMSQVSPPCSNSSPRESPKLVPHPTPPHATPP 365
            .........|.|.:.:.:  |.::|||..:.|..|.......|.|
Mouse   301 RMKAREHSEAVLQSANLL--PSTSSSPGPASKQAPPEGSQDKTSP 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 37/52 (71%)
Prrxl1XP_006518472.1 Homeobox 128..181 CDD:365835 38/52 (73%)
OAR 292..309 CDD:367680 2/16 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.