DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and rax2

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_002941436.1 Gene:rax2 / 100494721 XenbaseID:XB-GENE-494483 Length:227 Species:Xenopus tropicalis


Alignment Length:204 Identity:73/204 - (35%)
Similarity:99/204 - (48%) Gaps:43/204 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 REDSPTNTDGGLDVDNDDELSSSLNNGHDLSDMERPRKVRRSRTTFTTFQLHQLERAFEKTQYPD 179
            |||..|.|.|..: ..|:||..              :|.||:||||||:|||:||||||::.|||
 Frog    13 REDGSTPTPGTPE-GEDNELPK--------------KKHRRNRTTFTTYQLHELERAFERSHYPD 62

  Fly   180 VFTREDLAMRLDLSEARVQVWFQNRRAKWRKREKFMNQDKAGYLLPEQGLPEFPLG--------- 235
            |::||:|||::.|.|.||||||||||||||::||........:..|.......|:.         
 Frog    63 VYSREELAMKVSLPEVRVQVWFQNRRAKWRRQEKLETSSSKLHDSPLLSFSRSPMATGVGPLSNT 127

  Fly   236 IPLPPHGLPGHPGSMQSEFWPPHFALHQHFNPAAAAAAGLLPQHLMAPHYKLPNFHTLLSQYMGL 300
            :||.|......||:..           .|..||..|     |...:.|.|:   .||.|:....:
 Frog   128 LPLEPWLTSPIPGTTT-----------VHSMPAFMA-----PSQALQPTYQ---SHTFLNSGPPM 173

  Fly   301 SNLNGIFGA 309
            :.:..:.||
 Frog   174 TPIQPLSGA 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 38/52 (73%)
rax2XP_002941436.1 Homeobox 40..93 CDD:365835 39/52 (75%)
OAR 200..216 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.