DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and alx4

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_004913406.1 Gene:alx4 / 100493396 XenbaseID:XB-GENE-853003 Length:376 Species:Xenopus tropicalis


Alignment Length:390 Identity:122/390 - (31%)
Similarity:158/390 - (40%) Gaps:134/390 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PPAM----RPAP----VQESPVSRPRAVYSIDQILGNQHQIKRSDTPSEVLITHPHHGHPHHIHH 73
            ||||    .|||    :|.||.   ||             .:.||..|.|.:.....|       
 Frog    12 PPAMDCYYSPAPQGRELQTSPF---RA-------------FQPSDKFSPVFLASKGQG------- 53

  Fly    74 LHSSNSNGS----------NHLSHQQQQQHS---QQQHHSQQQQQQQQLQVQA----------KR 115
             ....|.||          |..|:..:||.|   .|.||...||||..|.:|:          |.
 Frog    54 -FGDKSRGSFQQECQSLDANVQSNSGEQQGSFTKYQAHHPSHQQQQSHLYMQSTPCKSPSDSLKV 117

  Fly   116 EDSP---------------TNTD-GGLD-----------VDNDDELSSSLNNGHDLSDMERPRKV 153
            :|||               .|:| .|:|           ..:.|..|..|......|:..:.:| 
 Frog   118 QDSPGDPLIPCYAKESALTPNSDHQGMDSGYITSKETAGKGSQDRGSGDLPMDKTESESNKGKK- 181

  Fly   154 RRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWFQNRRAKWRKREKF--MN 216
            ||:|||||::||.:||:.|:||.||||:.||.||||.||:|||||||||||||||||||:|  |.
 Frog   182 RRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQ 246

  Fly   217 QDKAGYLLPEQGLPEFPL---------------------GIPLPPHGLPGHPGSMQSEFWPPHFA 260
            |.:..:    ....|.||                     |.|:|...:   |....|....||  
 Frog   247 QVRTHF----SSAYELPLLTRAENYAQIQNPSWIGNNGGGSPVPACVV---PCDTVSSCMSPH-- 302

  Fly   261 LHQHFNPAAAAAAGLLPQHLMAPHYKLPNFHTLLSQYMGLSNLNGIFGAGAAAAAAAASAGYPQN 325
            .|.|       :||.:.:.|..|.   |..|      :|.:::.|:||   :||......||..|
 Frog   303 SHPH-------SAGGVSEFLSVPG---PGAH------VGQTHMGGLFG---SAAMGPGINGYDLN 348

  Fly   326  325
             Frog   349  348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 38/52 (73%)
alx4XP_004913406.1 COG5576 120..266 CDD:227863 62/150 (41%)
Homeobox 185..238 CDD:365835 39/52 (75%)
OAR 352..370 CDD:367680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.