DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and DUXB

DIOPT Version :10

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001338236.1 Gene:DUXB / 100033411 HGNCID:33345 Length:345 Species:Homo sapiens


Alignment Length:181 Identity:51/181 - (28%)
Similarity:82/181 - (45%) Gaps:46/181 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 GHD----LSDMERPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSEARVQVWF 201
            |||    |:....|::.|:.:|..|..|.::|.:|||:..:||:.||:.||.:..|.|:|:|:||
Human    86 GHDQSQHLTQEYLPKEARQKQTFITWTQKNRLVQAFERNPFPDIATRKKLAEQTGLQESRIQMWF 150

  Fly   202 QNRRAKWRKREKF--MNQDKAGYLL-------PEQGLPEFPLGIPLP---------PHGLPGHP- 247
            |.:|:.:.|:.:.  ||      ||       |:..:...|:.:.||         .|...||. 
Human   151 QKQRSLYLKKSRMEPMN------LLVDDPNERPDATVGWHPINLFLPTDSSHYFSCSHSSSGHET 209

  Fly   248 -----GSMQSEFWPPHFALHQHFN-----PAAAAAAG-------LLPQHLM 281
                 .|.|:.:.|..|.:.|..|     |..|...|       ::|.||:
Human   210 LPPVLPSTQAPWDPFRFHVSQGPNVMIMQPTQAVQEGEKSDQPLIIPNHLL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeodomain 154..210 CDD:459649 22/55 (40%)
DUXBNP_001338236.1 homeodomain 16..72 CDD:238039
homeodomain 103..161 CDD:238039 23/57 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..314
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.