DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hbn and alx4a

DIOPT Version :9

Sequence 1:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_001340966.1 Gene:alx4a / 100006399 ZFINID:ZDB-GENE-070712-3 Length:368 Species:Danio rerio


Alignment Length:346 Identity:105/346 - (30%)
Similarity:149/346 - (43%) Gaps:79/346 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YSIDQILGNQHQ------IKRSDTP-SEVLITHPHHGH--------PHHIHHLHSSNSNGSNHLS 86
            ||.....|..||      .:.|||. |...:|:...|:        ......|.::...|:.:..
Zfish    19 YSPSAPQGRDHQANPFRTFQASDTKYSPAFLTNKGQGYGEKSGSPFQQECQSLDATAGEGTFNKY 83

  Fly    87 HQQQQQHSQQQHHSQQQQQQQQL-----QVQAKREDS--------PTNTD-GGLD---------- 127
            |...|:.|.:......:.||:..     .:....:||        |.|:| .|:|          
Zfish    84 HLFMQRSSCKTPPDSSKLQQENSGHNGGLIACYGKDSTGLTDSELPQNSDPAGMDGSYLSVKDSG 148

  Fly   128 VDNDDELSSSLNNGHDLSDMERPR-KVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLD 191
            |.:..:.:|.|.:..|.::.|..: |.||:|||||::||.:||:.|:||.||||:.||.||:|.|
Zfish   149 VKSPQQATSELASPLDKTEGESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLALRTD 213

  Fly   192 LSEARVQVWFQNRRAKWRKREKF--MNQDK----AGYLLPEQGLPEFPLGIPLP--------PHG 242
            |:|||||||||||||||||||:|  |.|.:    ..|.||....||....|..|        ...
Zfish   214 LTEARVQVWFQNRRAKWRKRERFGQMQQVRTHFSTAYELPLLTRPENYAQIQNPSWIGGSSAASP 278

  Fly   243 LPG--HPGSMQSEFWPPHFALHQHFNPAAAAAAGLLPQHLMAPHYKLPNFHTLLSQYMGLSNLNG 305
            :||  .|....:...|||        |.||:.   :...|..|.   |..|      ||.:::..
Zfish   279 VPGCVVPCDSVTSCMPPH--------PHAASG---VSDFLGVPS---PGSH------MGQTHMGS 323

  Fly   306 IFGAGAAAAAAAASAGYPQNL 326
            :||   :........||..|:
Zfish   324 LFG---SPGMGTGINGYDLNM 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hbnNP_788420.1 Homeobox 156..209 CDD:278475 37/52 (71%)
alx4aXP_001340966.1 Homeobox 179..231 CDD:278475 37/51 (73%)
OAR 344..361 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.