DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and Cetn1

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_445913.1 Gene:Cetn1 / 84592 RGDID:620246 Length:172 Species:Rattus norvegicus


Alignment Length:175 Identity:51/175 - (29%)
Similarity:89/175 - (50%) Gaps:24/175 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ATKSVKKK-----PFTEVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIRE 82
            |:.|.|||     ..||.:.:::|.||||.|.:..|.:...||:..::.||.....|.:..:|.|
  Rat    11 ASTSYKKKVGPKPELTEDQKQEVREAFDLFDSDGSGTIDVKELKVAMRALGFEPRKEEMKKMISE 75

  Fly    83 ASHSGNGLINEAEFLQWVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFI 147
            ......|.|:..:||       |:..::.:.:|:|            |:::.|||:||.|..|.|
  Rat    76 VDKEATGKISFNDFL-------AVMTQKMAEKDTK------------EEILKAFRLFDDDETGKI 121

  Fly   148 TRDELQTAMEMIGEPLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
            :...|:.....:||.|.:::|::::..||.|.||.:|.|||.:::
  Rat   122 SFKNLKRVANELGESLTDEELQEMIDEADRDGDGEVNEEEFLKIM 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 46/160 (29%)
Cetn1NP_445913.1 PTZ00183 15..172 CDD:185503 49/171 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.