DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and AT1G73630

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_177504.1 Gene:AT1G73630 / 843697 AraportID:AT1G73630 Length:163 Species:Arabidopsis thaliana


Alignment Length:162 Identity:39/162 - (24%)
Similarity:81/162 - (50%) Gaps:26/162 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PFTEVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEAE 95
            |.|::|:|.:   ||..|.|.||:::.:||..:.|::|.:.::|.::.::.|.....:|.||:.|
plant    15 PSTDMELKKV---FDKFDANGDGKISVSELGNVFKSMGTSYTEEELNRVLDEIDIDCDGFINQEE 76

  Fly    96 FLQWVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMIG 160
            |                   :...:....|.::.|    ||.::|::.||.|:..|:...:..:|
plant    77 F-------------------ATICRSSSSAVEIRE----AFDLYDQNKNGLISSSEIHKVLNRLG 118

  Fly   161 EPLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
            ...:.:...:::...|.|.||.:|:|||.:::
plant   119 MTCSVEDCVRMIGHVDTDGDGNVNFEEFQKMM 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 38/160 (24%)
AT1G73630NP_177504.1 PTZ00184 20..152 CDD:185504 37/157 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.