DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and AT1G32250

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_174504.1 Gene:AT1G32250 / 840117 AraportID:AT1G32250 Length:166 Species:Arabidopsis thaliana


Alignment Length:166 Identity:61/166 - (36%)
Similarity:85/166 - (51%) Gaps:19/166 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KPFTEVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEA 94
            |...|.:|.:||..|...|||:||.:|..||..:|:.||:..|.:....||.:|....|||:...
plant     7 KKLDEEQINELREIFRSFDRNKDGSLTQLELGSLLRALGVKPSPDQFETLIDKADTKSNGLVEFP 71

  Fly    95 EFLQWVGRIQALRDEQHSHE---DSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAM 156
            ||:..|           |.|   .:|.:.|..|     |.|:..||:||.|||||||..||..:|
plant    72 EFVALV-----------SPELLSPAKRTTPYTE-----EQLLRLFRIFDTDGNGFITAAELAHSM 120

  Fly   157 EMIGEPLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
            ..:|..|...:|..::..||.|.|||||::||.:.:
plant   121 AKLGHALTVAELTGMIKEADSDGDGRINFQEFAKAI 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 60/163 (37%)
AT1G32250NP_174504.1 PTZ00184 8..158 CDD:185504 60/165 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.