DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and AT1G32250

DIOPT Version :10

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_174504.1 Gene:AT1G32250 / 840117 AraportID:AT1G32250 Length:166 Species:Arabidopsis thaliana


Alignment Length:166 Identity:61/166 - (36%)
Similarity:85/166 - (51%) Gaps:19/166 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KPFTEVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEA 94
            |...|.:|.:||..|...|||:||.:|..||..:|:.||:..|.:....||.:|....|||:...
plant     7 KKLDEEQINELREIFRSFDRNKDGSLTQLELGSLLRALGVKPSPDQFETLIDKADTKSNGLVEFP 71

  Fly    95 EFLQWVGRIQALRDEQHSHE---DSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAM 156
            ||:..|           |.|   .:|.:.|..|     |.|:..||:||.|||||||..||..:|
plant    72 EFVALV-----------SPELLSPAKRTTPYTE-----EQLLRLFRIFDTDGNGFITAAELAHSM 120

  Fly   157 EMIGEPLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
            ..:|..|...:|..::..||.|.|||||::||.:.:
plant   121 AKLGHALTVAELTGMIKEADSDGDGRINFQEFAKAI 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 60/163 (37%)
AT1G32250NP_174504.1 PTZ00184 8..158 CDD:185504 60/165 (36%)

Return to query results.
Submit another query.