DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and AT1G05990

DIOPT Version :10

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_172089.1 Gene:AT1G05990 / 837108 AraportID:AT1G05990 Length:150 Species:Arabidopsis thaliana


Alignment Length:158 Identity:49/158 - (31%)
Similarity:88/158 - (55%) Gaps:24/158 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEAEFLQWVGRI 103
            :|:..|.:.|:|.||.:|..||...|::|||.:.|:.:..:|.:...:|:|.::..||.:....|
plant     5 ELKRVFQMFDKNGDGTITGKELSETLRSLGIYIPDKELTQMIEKIDVNGDGCVDIDEFGELYKTI 69

  Fly   104 QALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMI----GEPLN 164
                              :||.|:..||:..||.|||::|:||||.|||:..:..:    |:.|:
plant    70 ------------------MDEEDEEEEDMKEAFNVFDQNGDGFITVDELKAVLSSLGLKQGKTLD 116

  Fly   165 EQQLEQLLVIADLDQDGRINYEEFTRLL 192
            :  .::::...|:|.|||:||:||.:::
plant   117 D--CKKMIKKVDVDGDGRVNYKEFRQMM 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 49/158 (31%)
AT1G05990NP_172089.1 PTZ00184 5..142 CDD:185504 49/156 (31%)

Return to query results.
Submit another query.