DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and CEN2

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001031798.1 Gene:CEN2 / 829855 AraportID:AT4G37010 Length:171 Species:Arabidopsis thaliana


Alignment Length:192 Identity:49/192 - (25%)
Similarity:95/192 - (49%) Gaps:31/192 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSPMSGLRQQLKMLGTALLGKRATKSVKKKPFTEVEIKDLRTAFDLLDRNRDGRVTANELQFMLK 65
            ||..:.||:.||..|            |....|..:.:::|..|||.|.:..|.:.|:||...::
plant     5 MSEAAQLRRGLKPKG------------KTYGLTNQKRREIREIFDLFDIDGSGSIDASELNVAMR 57

  Fly    66 NLGINVSDELIHDLIREASHSGNGLINEAEFLQWVGRIQALRDEQHSHEDSKDSKPVDEADDVTE 130
            :||..::::.|::|:.|...:.:|.|:..||:..:                  :....|.|.: :
plant    58 SLGFEMNNQQINELMAEVDKNQSGAIDFDEFVHMM------------------TTKFGERDSI-D 103

  Fly   131 DLIAAFRVFDRDGNGFITRDELQTAMEMIGEPLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
            :|..||::.|.|.||.|:..:::...:.:||...:..:|:::..||.|:||.:|.|||.:::
plant   104 ELSKAFKIIDHDNNGKISPRDIKMIAKELGENFTDNDIEEMIEEADRDKDGEVNLEEFMKMM 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 41/160 (26%)
CEN2NP_001031798.1 PTZ00183 15..169 CDD:185503 45/182 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.