DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and CPK18

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001190932.1 Gene:CPK18 / 829763 AraportID:AT4G36070 Length:561 Species:Arabidopsis thaliana


Alignment Length:195 Identity:60/195 - (30%)
Similarity:99/195 - (50%) Gaps:29/195 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSPMSGLRQQLKMLGTALLGKRATKSVKKKPFTEVEIKDLRTAFDLLDRNRDGRVTANEL-QFML 64
            :|.::.:||.:|......:..||.    .|...|.|:.|||..||.:|.:::|.::..|: |.:.
plant   344 ISVLNNMRQFVKFSRLKQIALRAL----AKTINEDELDDLRDQFDAIDIDKNGSISLEEMRQALA 404

  Fly    65 KNLGINVSDELIHDLIREASHSGNGLINEAEFLQWVGRIQALRDEQHSHEDSKDSKPVDEADDVT 129
            |::...:.|..:.::::....:.:||::..||:     :.||...|....||:..:....     
plant   405 KDVPWKLKDARVAEILQANDSNTDGLVDFTEFV-----VAALHVNQLEEHDSEKWQQRSR----- 459

  Fly   130 EDLIAAFRVFDRDGNGFITRDE--LQTAMEMIGEPLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
                |||..||.||:||||.:|  |||.::...|||.|:        ||:|:||||:..||.|||
plant   460 ----AAFDKFDIDGDGFITPEELRLQTGLKGSIEPLLEE--------ADVDEDGRISINEFRRLL 512

  Fly   193  192
            plant   513  512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 53/163 (33%)
CPK18NP_001190932.1 STKc_CAMK 70..330 CDD:270687
S_TKc 71..331 CDD:214567
PTZ00184 367..514 CDD:185504 54/172 (31%)
EFh 378..437 CDD:238008 14/58 (24%)
EFh 459..513 CDD:238008 31/71 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.