Sequence 1: | NP_524902.2 | Gene: | Eip63F-1 / 47878 | FlyBaseID: | FBgn0004910 | Length: | 193 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001190932.1 | Gene: | CPK18 / 829763 | AraportID: | AT4G36070 | Length: | 561 | Species: | Arabidopsis thaliana |
Alignment Length: | 195 | Identity: | 60/195 - (30%) |
---|---|---|---|
Similarity: | 99/195 - (50%) | Gaps: | 29/195 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSPMSGLRQQLKMLGTALLGKRATKSVKKKPFTEVEIKDLRTAFDLLDRNRDGRVTANEL-QFML 64
Fly 65 KNLGINVSDELIHDLIREASHSGNGLINEAEFLQWVGRIQALRDEQHSHEDSKDSKPVDEADDVT 129
Fly 130 EDLIAAFRVFDRDGNGFITRDE--LQTAMEMIGEPLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
Fly 193 192 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Eip63F-1 | NP_524902.2 | PTZ00184 | 33..193 | CDD:185504 | 53/163 (33%) |
CPK18 | NP_001190932.1 | STKc_CAMK | 70..330 | CDD:270687 | |
S_TKc | 71..331 | CDD:214567 | |||
PTZ00184 | 367..514 | CDD:185504 | 54/172 (31%) | ||
EFh | 378..437 | CDD:238008 | 14/58 (24%) | ||
EFh | 459..513 | CDD:238008 | 31/71 (44%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |