DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and CAM8

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_193200.1 Gene:CAM8 / 827114 AraportID:AT4G14640 Length:151 Species:Arabidopsis thaliana


Alignment Length:167 Identity:56/167 - (33%)
Similarity:98/167 - (58%) Gaps:19/167 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VKKKPFTEVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLI 91
            :::...|:.:|.:.:.||.|.|::.||.:|..||..::::|..|.:::.:||:|.|.....||.|
plant     1 MEETALTKDQITEFKEAFCLFDKDGDGCITVEELATVIRSLDQNPTEQELHDIITEIDSDSNGTI 65

  Fly    92 NEAEFLQWVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAM 156
            ..||||..:                  :|.:.|: |..|:|..||:|||:|.||:|:..||...|
plant    66 EFAEFLNLM------------------AKKLQES-DAEEELKEAFKVFDKDQNGYISASELSHVM 111

  Fly   157 EMIGEPLNEQQLEQLLVIADLDQDGRINYEEFTRLLL 193
            ..:||.|.::::||::..||||.||::||:||.::::
plant   112 INLGEKLTDEEVEQMIKEADLDGDGQVNYDEFVKMMI 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 56/159 (35%)
CAM8NP_193200.1 PTZ00184 6..148 CDD:185504 56/160 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.