DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and AT3G59440

DIOPT Version :10

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_191503.1 Gene:AT3G59440 / 825113 AraportID:AT3G59440 Length:195 Species:Arabidopsis thaliana


Alignment Length:156 Identity:51/156 - (32%)
Similarity:87/156 - (55%) Gaps:22/156 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEAEFLQWVGRI 103
            ||:..|.:.|:|.|||:|..||...|:||||.:.|:.:..:|::...:|:|.::..||....|.|
plant    51 DLKRVFQMFDKNGDGRITKEELNDSLENLGIFMPDKDLIQMIQKMDANGDGCVDINEFESLYGSI 115

  Fly   104 QALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMIG--EPLNEQ 166
                              |:|.::  .|:..||.|||:||:||||.:||.:.|..:|  :....:
plant   116 ------------------VEEKEE--GDMRDAFNVFDQDGDGFITVEELNSVMTSLGLKQGKTLE 160

  Fly   167 QLEQLLVIADLDQDGRINYEEFTRLL 192
            ..:::::..|.|.|||:||:||.:::
plant   161 CCKEMIMQVDEDGDGRVNYKEFLQMM 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 51/156 (33%)
AT3G59440NP_191503.1 PTZ00184 41..188 CDD:185504 51/156 (33%)

Return to query results.
Submit another query.