DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and AGD11

DIOPT Version :10

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_187405.1 Gene:AGD11 / 819937 AraportID:AT3G07490 Length:153 Species:Arabidopsis thaliana


Alignment Length:156 Identity:47/156 - (30%)
Similarity:87/156 - (55%) Gaps:21/156 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEAEFLQWVGRI 103
            :|...|.:.|||.||::|..||...|:||||.:.|:.:..:|.:...:|:|.::..||   .|..
plant     5 ELARIFQMFDRNGDGKITKQELNDSLENLGIYIPDKDLVQMIEKIDLNGDGYVDIEEF---GGLY 66

  Fly   104 QALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMIG--EPLNEQ 166
            |.:.:|:            ||.:|:.|    ||.|||::.:||||.:||::.:..:|  :....:
plant    67 QTIMEER------------DEEEDMRE----AFNVFDQNRDGFITVEELRSVLASLGLKQGRTLE 115

  Fly   167 QLEQLLVIADLDQDGRINYEEFTRLL 192
            ..::::...|:|.||.:|::||.:::
plant   116 DCKRMISKVDVDGDGMVNFKEFKQMM 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 47/156 (30%)
AGD11NP_187405.1 PTZ00184 4..141 CDD:185504 47/154 (31%)

Return to query results.
Submit another query.