DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and Efcab6

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:XP_006521594.2 Gene:Efcab6 / 77627 MGIID:1924877 Length:1536 Species:Mus musculus


Alignment Length:166 Identity:36/166 - (21%)
Similarity:73/166 - (43%) Gaps:15/166 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEAEFLQWVG-- 101
            |::..|.:||||.:..||..:|:.::....|.::.:...||:.:...|..|.:...|||...|  
Mouse   120 DIKKVFQILDRNHNQMVTKGDLKRVITAFLIPLTKDQFQDLLAQIPISSLGNVPYLEFLSRFGGG 184

  Fly   102 ---RIQALRDEQHSHEDSKDSKPVDEADDVTEDLI-------AAFRVFDRDGNGFITRDELQTAM 156
               .|..::   ..:|:..|::...:...:||.:.       ..|:|.|.:..|.:...||:..:
Mouse   185 IDININGIK---RVNENEVDNRRTVKEVQLTEKIFRNMRSIRKVFQVMDVNNTGLVQPQELRRVL 246

  Fly   157 EMIGEPLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
            |.....:.:...|:.|...::|:...::|..|.:.|
Mouse   247 ETFCLRMQDGDYEKFLEQYNIDKTTAVDYNAFLKNL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 36/166 (22%)
Efcab6XP_006521594.2 FRQ1 119..285 CDD:227455 36/166 (22%)
FRQ1 338..501 CDD:227455
EFh_PEF 787..>952 CDD:355382
EF-hand motif 787..823 CDD:320054
EF-hand motif 828..889 CDD:320054
EF-hand motif 890..922 CDD:320054
EFh_PI-PLC 894..1004 CDD:333715
EF-hand motif 894..922 CDD:320029
EF-hand_7 898..952 CDD:372618
EF-hand motif 929..954 CDD:320029
EF-hand_11 1197..1301 CDD:370222
PTZ00183 1364..1532 CDD:185503
EF-hand_7 1474..1534 CDD:372618
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.