DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and Calml4

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001121047.1 Gene:Calml4 / 691455 RGDID:1583918 Length:153 Species:Rattus norvegicus


Alignment Length:159 Identity:32/159 - (20%)
Similarity:76/159 - (47%) Gaps:19/159 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KPFTEVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEA 94
            |..::.:|.:.:..|.|.|:.:.|::.|.:|...::.||.:.:...:...::......||.::.:
  Rat     3 KFLSQEQINEYKECFSLYDKQQRGKIKATDLLVSMRCLGASPTPGEVQRHLQTHGIDKNGELDFS 67

  Fly    95 EFLQWVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMI 159
            .||       .:...|...||.|            ::::.|..:.|::..|:|...||::.:..:
  Rat    68 TFL-------TIMHMQIKQEDPK------------KEILLAMLMTDKEKKGYIMASELRSKLMKL 113

  Fly   160 GEPLNEQQLEQLLVIADLDQDGRINYEEF 188
            ||.|..:::::|...|.::.:|::.|:.|
  Rat   114 GEKLTHKEVDELFKEAGIEPNGQVKYDTF 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 31/156 (20%)
Calml4NP_001121047.1 PTZ00184 1..144 CDD:185504 32/159 (20%)
EFh 12..74 CDD:238008 12/68 (18%)
EFh 94..147 CDD:298682 13/49 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.