DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and Cetn4

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001258080.1 Gene:Cetn4 / 688611 RGDID:1586489 Length:168 Species:Rattus norvegicus


Alignment Length:176 Identity:53/176 - (30%)
Similarity:85/176 - (48%) Gaps:24/176 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RATKSVKKKPFTEVEIKD-----LRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIR 81
            |.|....||...:||:.|     ::.||||.|.:..|.:...||:..::.||.....|.:..||.
  Rat     6 RTTLDQWKKKAAKVELNDTQKQEIKEAFDLFDIDGSGTIDLKELKIAMRALGFEPKKEEVKQLIT 70

  Fly    82 EASHSGNGLINEAEFLQWVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGF 146
            |....|.|.|...:|.       |:...:.|.:|.|            |:::.||::||.|..|.
  Rat    71 EIDKEGTGTICFEDFF-------AIMSIKMSEKDEK------------EEILKAFKLFDDDATGS 116

  Fly   147 ITRDELQTAMEMIGEPLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
            |:.:.::...:.:||.|.|.:|:::|..||.|.||.||.|||.:::
  Rat   117 ISLNNIKRVAKELGENLTEDELQEMLDEADRDGDGEINEEEFLKMM 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 49/165 (30%)
Cetn4NP_001258080.1 PTZ00183 13..168 CDD:185503 51/169 (30%)
EFh 28..90 CDD:238008 19/68 (28%)
EFh 101..163 CDD:238008 23/62 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.020

Return to query results.
Submit another query.