DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and pvalb2

DIOPT Version :10

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_571591.1 Gene:pvalb2 / 58028 ZFINID:ZDB-GENE-000322-4 Length:109 Species:Danio rerio


Alignment Length:66 Identity:22/66 - (33%)
Similarity:35/66 - (53%) Gaps:3/66 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 EDLIAAFRVFDRDGNGFITRDELQTAMEMI---GEPLNEQQLEQLLVIADLDQDGRINYEEFTRL 191
            :|:..||.|.|:|.:|||..|||:..::..   ...|.:.:.:..|...|.|.||:|..:||..|
Zfish    42 DDIKKAFFVIDQDKSGFIEEDELKLFLQNFSAGARALTDAETKAFLSAGDSDGDGKIGVDEFALL 106

  Fly   192 L 192
            :
Zfish   107 V 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 22/66 (33%)
pvalb2NP_571591.1 EFh_parvalbumin_beta 9..109 CDD:319998 22/66 (33%)
EF-hand motif 9..38 CDD:319998
EF-hand motif 43..72 CDD:319998 12/28 (43%)
EF-hand motif 82..109 CDD:319998 9/26 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.