DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eip63F-1 and calml4a

DIOPT Version :9

Sequence 1:NP_524902.2 Gene:Eip63F-1 / 47878 FlyBaseID:FBgn0004910 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001124246.1 Gene:calml4a / 560151 ZFINID:ZDB-GENE-081022-9 Length:153 Species:Danio rerio


Alignment Length:163 Identity:39/163 - (23%)
Similarity:81/163 - (49%) Gaps:19/163 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KPFTEVEIKDLRTAFDLLDRNRDGRVTANELQFMLKNLGINVSDELIHDLIREASHSGNGLINEA 94
            |..::.:|.:.:..|.|.|:.|.|::.|.:|..:::.||.:.:...:...::.......|.::.:
Zfish     3 KFLSQNQIDEFKECFSLYDKKRKGKIEAKDLITVMRCLGTSPTYNEVDRHLQVHKIDKTGELDFS 67

  Fly    95 EFLQWVGRIQALRDEQHSHEDSKDSKPVDEADDVTEDLIAAFRVFDRDGNGFITRDELQTAMEMI 159
            .||..:.|       |...||.|            .:::.|.|:.|:...|:|...||:..:..:
Zfish    68 TFLTMMHR-------QMQQEDPK------------TEILEAMRMTDKHKKGYIQASELRAKLTGL 113

  Fly   160 GEPLNEQQLEQLLVIADLDQDGRINYEEFTRLL 192
            ||.|.::::::|...|.:.:||.::||||||::
Zfish   114 GEKLTDKEVDELFKEAHVGRDGLVHYEEFTRMV 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eip63F-1NP_524902.2 PTZ00184 33..193 CDD:185504 38/160 (24%)
calml4aNP_001124246.1 PTZ00184 1..147 CDD:185504 39/163 (24%)
EFh 12..74 CDD:238008 12/61 (20%)
EFh 85..147 CDD:238008 20/62 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.